APE1/Ref-1 overview
Apurinic apyrimidinic endonuclease 1/Redox factor-1 (APE1/Ref-1) is a multifunctional protein; its N-terminal region is involved in redox activity and regulates multiple transcription factors, and its C-terminus is involved in base excision DNA repair activity. APE1/Ref-1 is mainly localized in the nucleus and shows dynamic shuttling between the nucleus and cytoplasm in response to various stress stimuli. Recently, it have a reported the possibility for the extracellular secretion of APE1/Ref-1. Elevated level of APE1/Ref-1 were observed in the blood of endotoxemic rats, and in bladder cancer.
APE1/Ref-1 protein, Human, Recombinant (His Tag) (MR-RPAPE-*** )
| Protein Gene name | APEX1 |
|---|
| Other name | APE1, Ref-1, APE1/Ref-1 |
|---|
| NCBI Reference Sequence | NM_001641.3 |
|---|
| Cat.No | MR-RPAPE-*** |
|---|
| AA Sequence | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRDPNSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPLYED
PPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLS
RQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNP
KGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDH
CPITLYLAL
|
|---|
| Size | 0.05, 0.1, 0.5, 1 mg/ml |
|---|
| Host | E. Coli |
|---|
| Form/ storage solution | Solution, containing 10mM Tris-HClpH8, 50mM Nacl, 1mM DTT, 0.05mM EDTA, 200 µg/ml BSA, 50% glycerol |
|---|
| Concentration | 1mg/ml |
|---|
| Protein Form | Full Length, Recombinant |
|---|
| Protein Tag or Fusion | N-terminal His tag |
|---|
| Protein size | 39 kDa |
|---|
| Purity | ≥ 95% by SDS-PAGE |
|---|
| Storage | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles |
|---|
References
- Robson, C.N. and Hickson, D.I. (1991) Nucleic Acids Res. 19, 5519–5523.
- Demple, B. et al. (1991) Proc. Natl. Acad. Sci. USA 88, 11450–11454.
- Park, M. et al, (2016) Sci Reports 6:23015.
0
